PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0438s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 348aa    MW: 39433.4 Da    PI: 6.5849
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0438s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.14.2e-54161421129
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+++yL +kv ++ + + ++i evd++k+ePwdLp ++k +ekewyfF+  d+ky+tg  +nrat++gyWkatg
  SapurV1A.0438s0020.1.p  16 LPPGFRFHPTDEELITHYLSQKVLDNYFCA-RAIGEVDLNKCEPWDLPWRAKMGEKEWYFFCVIDRKYPTGLWTNRATDAGYWKATG 101
                             79*************************988.89***************888999********************************* PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                             kdke+++  ++lvglkktLvfykgrapkgekt+Wvmheyrle
  SapurV1A.0438s0020.1.p 102 KDKEIFK-AKTLVGLKKTLVFYKGRAPKGEKTNWVMHEYRLE 142
                             *******.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-619166IPR003441NAC domain
PROSITE profilePS5100557.06416166IPR003441NAC domain
PfamPF023655.4E-2917141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MENNSMYSEE DEQMELPPGF RFHPTDEELI THYLSQKVLD NYFCARAIGE VDLNKCEPWD  60
LPWRAKMGEK EWYFFCVIDR KYPTGLWTNR ATDAGYWKAT GKDKEIFKAK TLVGLKKTLV  120
FYKGRAPKGE KTNWVMHEYR LEGKTPVYNH PKTGKNDWVI CRIFEKSSGG KKTHISGLVR  180
LSSYGNELKP SLLPPLMDSS QLNSDKRTNI GDNSHVTCFS NPMEDHKPHE TIADSFNSFR  240
GAPLSCSSMS PSSVLSSKPS PPNSFYSPQI LPNIASFLYP DSAMMPEHPS MSRILLENLN  300
SKRELSEDTG LSTGMSSVVS DHELVHRSFE DPSSSAGQVD LDYLWNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-541317214171NO APICAL MERISTEM PROTEIN
1ut4_B1e-541317214171NO APICAL MERISTEM PROTEIN
1ut7_A1e-541317214171NO APICAL MERISTEM PROTEIN
1ut7_B1e-541317214171NO APICAL MERISTEM PROTEIN
4dul_A1e-541317214171NAC domain-containing protein 19
4dul_B1e-541317214171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011035791.10.0PREDICTED: NAC domain-containing protein 100-like
SwissprotQ9FLJ21e-126NC100_ARATH; NAC domain-containing protein 100
TrEMBLB9IK050.0B9IK05_POPTR; Uncharacterized protein
STRINGPOPTR_0017s12210.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-125NAC domain containing protein 100